PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g062160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 715aa    MW: 80702.6 Da    PI: 6.7185
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g062160.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox597.8e-192981456
                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     + ++++q+++Lee+F+++++p+  +r++LA++l+L+ +q+k+WFqN+R++ k
  Csa17g062160.1 29 HQHHSNHQIHRLEEYFNECPHPDDLQRRRLAEELNLKPKQIKFWFQNKRTQVK 81
                    56789********************************************9876 PP

2START106.54.3e-342354572206
                     HHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEE..EESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss........esengdevlqk..feeskvdsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     +a +a +e++++++ ee +W kss         ++++++++++  f++++v + e +++++vv m++++lv  ++d+  +W + ++    +a+tl
  Csa17g062160.1 235 MAAKAVAEVMSLIKMEESMWIKSSidgrlvidPGNYEKISTKInhFKSTNV-RPESSKEVVVVQMAATNLVDMFFDTE-KWARLFPtivnEAKTL 327
                     5788999**********************9974444444433311556666.9999**********************.9999999999977777 PP

                     EEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
           START  83 evissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvd 171
                      v++s      ++  +++ +   lsplvp R f ++R+++q +++ w+i+dvS   ++    +     ++++pSg li+ +++g skvtw+ehv+
  Csa17g062160.1 328 HVLDSIdhgrqTFSKVIYEQEHILSPLVPpRQFIILRSCQQVEEDLWLIADVSCHLPNVEL-DFTAPLCTKRPSGVLIQALPDGSSKVTWIEHVE 421
                     776665566*988899999999999****************************88887765.56666699************************* PP

                     --SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 172 lkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                     +++++  h l++ l+ sg   ga++w+ tl+r ce+
  Csa17g062160.1 422 VNDNVRpHRLYKDLLYSGFGYGARRWTVTLERMCER 457
                     ****955***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.22E-171383IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-181584IPR009057Homeodomain-like
PROSITE profilePS5007116.3422383IPR001356Homeobox domain
SMARTSM003893.2E-172587IPR001356Homeobox domain
CDDcd000861.51E-162684No hitNo description
PfamPF000463.6E-163081IPR001356Homeobox domain
PROSITE patternPS0002705881IPR017970Homeobox, conserved site
PROSITE profilePS5084841.756225460IPR002913START domain
SuperFamilySSF559611.02E-25228458No hitNo description
CDDcd088751.07E-84229456No hitNo description
SMARTSM002342.0E-17234457IPR002913START domain
PfamPF018525.1E-28235457IPR002913START domain
Gene3DG3DSA:3.30.530.201.1E-5290423IPR023393START-like domain
SuperFamilySSF559618.24E-9480681No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    Send to blast
MVSSRDDTSI DERGTSSMDT NDNQERSNHQ HHSNHQIHRL EEYFNECPHP DDLQRRRLAE  60
ELNLKPKQIK FWFQNKRTQV KIQNEKAENA ELRIDNLKMK CENEAMEEAL KTVVCPPCGG  120
RHPGREEQLL YLRKLRAENA FLERERERLS TYVSQHRGHS IPSFDAYLHG PSTSNNRPAS  180
YGTSSNHLPT QSSLLRGPYT RENINVTPPP KPQNSVLLQH FQPLPQPEKI VMFEMAAKAV  240
AEVMSLIKME ESMWIKSSID GRLVIDPGNY EKISTKINHF KSTNVRPESS KEVVVVQMAA  300
TNLVDMFFDT EKWARLFPTI VNEAKTLHVL DSIDHGRQTF SKVIYEQEHI LSPLVPPRQF  360
IILRSCQQVE EDLWLIADVS CHLPNVELDF TAPLCTKRPS GVLIQALPDG SSKVTWIEHV  420
EVNDNVRPHR LYKDLLYSGF GYGARRWTVT LERMCERLSL YSMSDFPATD HAGVVKTIEG  480
RRSVMNLGER MLKNFAWIMK MSDKQDFSQQ CDTNNSGVRI SVRTNIEAGQ PTGLIVCASS  540
SLYLPLTPLR VYDFLSNLEV RHQWDVLCHG NPATEAARFV TGSDQKNNVT FLKPSSGGDN  600
SELMILQDGF IDALGGMFVY APVDLNTAYS AISGQVDPST IPVLPSGFII SRDSRRPSVG  660
ELDSGRMTLL TVAFQILVSG SSHSIDLNVE DSATTVHILI SSTVQRVKAM LNCE*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010478910.10.0PREDICTED: homeobox-leucine zipper protein HDG10-like
SwissprotQ9S9Z00.0HDG10_ARATH; Homeobox-leucine zipper protein HDG10
TrEMBLR0H7P30.0R0H7P3_9BRAS; Uncharacterized protein
STRINGAT1G34650.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84681531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34650.10.0homeodomain GLABROUS 10